GABARAPL1 antibody
-
- Target See all GABARAPL1 Antibodies
- GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GABARAPL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
- Top Product
- Discover our top product GABARAPL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GABARAPL1 Blocking Peptide, catalog no. 33R-6137, is also available for use as a blocking control in assays to test for specificity of this GABARAPL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))
- Alternative Name
- GABARAPL1 (GABARAPL1 Products)
- Synonyms
- gabarapl1 antibody, apg8l antibody, atg8 antibody, atg8l antibody, gec1 antibody, gabarapl1-a antibody, GABARAPL3 antibody, APG8-LIKE antibody, APG8L antibody, ATG8 antibody, ATG8B antibody, ATG8L antibody, GEC1 antibody, Gec1 antibody, 3110025G09Rik antibody, 9130422N19Rik antibody, AI196471 antibody, Apg8l antibody, Atg8l antibody, GECI antibody, GEC-1 antibody, GABA(A) receptor-associated protein like 1 antibody, GABA(A) receptor-associated protein like 1 S homeolog antibody, GABA type A receptor associated protein like 1 antibody, gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 antibody, gabarapl1 antibody, gabarapl1.S antibody, GABARAPL1 antibody, Gabarapl1 antibody
- Background
- GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Autophagy
-