Catalase antibody (Middle Region)

Catalog No. ABIN631595

Product Details anti-Catalase Antibody

Target: Catalase (CAT)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Catalase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Catalase antibody was raised against the middle region of CAT

Purification: Affinity purified

Immunogen: Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Catalase Blocking Peptide, catalog no. 33R-5077, is also available for use as a blocking control in assays to test for specificity of this Catalase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Catalase antibody (ABIN631595)

Makkar, Contreras, Paintlia, Smith, Haq, Singh: "Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." in: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).

Target Details for Catalase

Target: Catalase (CAT)

Alternative Name: Catalase (CAT Products)

Synonyms: 2210418N07 antibody, Cas-1 antibody, Cas1 antibody, Cs-1 antibody, CS1 antibody, Cat01 antibody, Catl antibody, fb68a12 antibody, wu:fb68a12 antibody, CAT antibody, CATA antibody, CG6871 antibody, CT21282 antibody, CatA antibody, DMCATHPO antibody, DROCATHPO antibody, Dmel\\CG6871 antibody, U00145 antibody, bs36h11.y1 antibody, cat antibody, GB11648 antibody, catalase antibody, Cat antibody, BA0843 antibody, DKFZp469E0232 antibody, catalase antibody, Catalase antibody, catalase, gene 2 antibody, CAT antibody, Cat antibody, cat antibody, cat.2 antibody, LOC769804 antibody, BA_0843 antibody

Background: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Cell RedoxHomeostasis, Photoperiodism