AGO4 antibody (Middle Region)

Catalog No. ABIN631614

Product Details anti-AGO4 Antibody

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGO4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF2 C4 antibody was raised against the middle region of EIF2 4

Purification: Affinity purified

Immunogen: EIF2 C4 antibody was raised using the middle region of EIF2 4 corresponding to a region with amino acids DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2C4 Blocking Peptide, catalog no. 33R-1952, is also available for use as a blocking control in assays to test for specificity of this EIF2C4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGO4

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Alternative Name: EIF2C4 (EIF2C4 Products)

Synonyms: EIF2C4 antibody, ago4 antibody, Argonaute4 antibody, argonaute-4 antibody, eif2c4 antibody, wu:fd14f04 antibody, ARGONAUTE 4 antibody, OCP11 antibody, OVEREXPRESSOR OF CATIONIC PEROXIDASE 11 antibody, T20P8.9 antibody, T20P8_9 antibody, Eif2c4 antibody, 5730550L01Rik antibody, AI481660 antibody, argonaute 4, RISC catalytic component antibody, argonaute 1, RISC catalytic component antibody, argonaute RISC catalytic component 4 antibody, Argonaute family protein antibody, argonaute 4, RISC catalytic component L homeolog antibody, argonaute RISC catalytic subunit 4 antibody, AGO4 antibody, ago1 antibody, ago4 antibody, Ago4 antibody, ago4.L antibody

Background: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Cellular Glucan Metabolic Process