ING3 antibody (Middle Region)
-
- Target See all ING3 Antibodies
- ING3 (Inhibitor of Growth Family, Member 3 (ING3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ING3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ING3 antibody was raised against the middle region of ING3
- Purification
- Affinity purified
- Immunogen
- ING3 antibody was raised using the middle region of ING3 corresponding to a region with amino acids LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE
- Top Product
- Discover our top product ING3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ING3 Blocking Peptide, catalog no. 33R-5453, is also available for use as a blocking control in assays to test for specificity of this ING3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ING3 (Inhibitor of Growth Family, Member 3 (ING3))
- Alternative Name
- ING3 (ING3 Products)
- Synonyms
- ING3 antibody, Eaf4 antibody, ING2 antibody, MEAF4 antibody, p47ING3 antibody, 1300013A07Rik antibody, P47ING3 antibody, zgc:56327 antibody, inhibitor of growth family member 3 antibody, inhibitor of growth family, member 3 antibody, inhibitor of growth protein 3 antibody, inhibitor of growth family member 3 L homeolog antibody, ING3 antibody, Ing3 antibody, CpipJ_CPIJ009396 antibody, ing3 antibody, ing3.L antibody
- Background
- ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.
- Molecular Weight
- 47 kDa (MW of target protein)
-