ANP32B antibody

Catalog No. ABIN631639

Product Details anti-ANP32B Antibody

Target: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANP32B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ANP32 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANP32B Blocking Peptide, catalog no. 33R-3427, is also available for use as a blocking control in assays to test for specificity of this ANP32B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANP32B

Target: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Alternative Name: ANP32B (ANP32B Products)

Synonyms: APRIL antibody, PHAPI2 antibody, SSP29 antibody, 2410015B15Rik antibody, PAL31 antibody, PHAPI2a antibody, Ssp29 antibody, cb908 antibody, fa99a11 antibody, wu:fa28c10 antibody, wu:fa99a11 antibody, wu:fb40e12 antibody, zgc:77745 antibody, hLAMP-1 antibody, MGC80871 antibody, ANP32B antibody, MGC69373 antibody, SLAN antibody, acidic nuclear phosphoprotein 32 family member B antibody, acidic (leucine-rich) nuclear phosphoprotein 32 family, member B antibody, acidic nuclear phosphoprotein 32 family member B L homeolog antibody, acidic leucine-rich nuclear phosphoprotein 32 family member B antibody, ANP32B antibody, Anp32b antibody, anp32b antibody, anp32b.L antibody, LOC494442 antibody

Background: ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-apoptotic protein which functions as a caspase-3 inhibitor. It has no phosphatase 2A (PP2A) inhibitor activity.

Molecular Weight: 29 kDa (MW of target protein)