UBE2D2 antibody
-
- Target See all UBE2D2 Antibodies
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2D2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF
- Top Product
- Discover our top product UBE2D2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2D2 Blocking Peptide, catalog no. 33R-1345, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
- Alternative Name
- UBE2D2 (UBE2D2 Products)
- Synonyms
- E2(17)KB2 antibody, PUBC1 antibody, UBC4 antibody, UBC4/5 antibody, UBCH5B antibody, 1500034D03Rik antibody, Ubc2e antibody, Ube2d2 antibody, ubc4 antibody, ube2d2 antibody, zgc:55886 antibody, E217kB antibody, ubiquitin conjugating enzyme E2 D2 antibody, ubiquitin-conjugating enzyme E2D 2A antibody, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) antibody, ubiquitin-conjugating enzyme E2D 2 antibody, ubiquitin conjugating enzyme E2 D3 antibody, UBE2D2 antibody, Ube2d2a antibody, ube2d2 antibody, Ube2d2 antibody, UBE2D3 antibody
- Background
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
- Molecular Weight
- 17 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Toll-Like Receptors Cascades
-