ACTN1 antibody (N-Term)
-
- Target See all ACTN1 Antibodies
- ACTN1 (Actinin, alpha 1 (ACTN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Alpha Actinin 1 antibody was raised against the N terminal of ACTN1
- Purification
- Affinity purified
- Immunogen
- alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
- Top Product
- Discover our top product ACTN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Alpha Actinin 1 Blocking Peptide, catalog no. 33R-1985, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTN1 (Actinin, alpha 1 (ACTN1))
- Alternative Name
- alpha Actinin 1 (ACTN1 Products)
- Synonyms
- ACTN1 antibody, actinin antibody, BDPLT15 antibody, 3110023F10Rik antibody, Actn1a antibody, actinin alpha 1 antibody, actinin, alpha 1 antibody, actinin alpha 1 L homeolog antibody, ACTN1 antibody, actn1 antibody, Actn1 antibody, actn1.L antibody
- Background
- Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments.
- Molecular Weight
- 103 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-