TSR1 antibody

Catalog No. ABIN631738

Product Details anti-TSR1 Antibody

Target: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSR1

Target: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Alternative Name: TSR1 (TSR1 Products)

Synonyms: AU040765 antibody, AW550801 antibody, mKIAA1401 antibody, TSR1 20S rRNA accumulation antibody, TSR1, ribosome maturation factor L homeolog antibody, TSR1, ribosome maturation factor antibody, Tsr1 antibody, tsr1.L antibody, TSR1 antibody

Background: TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly