Crossover junction endonuclease EME1 (EME1) antibody

Catalog No. ABIN631739

Product Details

Target: Crossover junction endonuclease EME1 (EME1)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EME1 Blocking Peptide, catalog no. 33R-1632, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Crossover junction endonuclease EME1 (EME1)

Alternative Name: EME1 (EME1 Products)

Synonyms: 6820428D13 antibody, essential meiotic structure-specific endonuclease 1 antibody, Eme1 antibody

Background: EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Molecular Weight: 63 kDa (MW of target protein)