SAE1 antibody (N-Term)

Catalog No. ABIN631747

Product Details anti-SAE1 Antibody

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAE1 antibody was raised against the N terminal of SAE1

Purification: Affinity purified

Immunogen: SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAE1 Blocking Peptide, catalog no. 33R-6581, is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAE1

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Alternative Name: SAE1 (SAE1 Products)

Synonyms: AOS1 antibody, HSPC140 antibody, SUA1 antibody, UBLE1A antibody, 2400010M20Rik antibody, 2610044L12Rik antibody, AL033372 antibody, AW743391 antibody, D7Ertd177e antibody, Sua1 antibody, Uble1a antibody, Aos1p antibody, Sua1p antibody, aos antibody, sae2a antibody, uble1a antibody, wu:fa28b04 antibody, zgc:86633 antibody, SUMO1 activating enzyme subunit 1 antibody, SUMO1 activating enzyme subunit 1 L homeolog antibody, SAE1 antibody, Sae1 antibody, sae1.L antibody, sae1 antibody

Background: Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Molecular Weight: 38 kDa (MW of target protein)