FASTKD2 antibody (Middle Region)
-
- Target See all FASTKD2 Antibodies
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FASTKD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FASTKD2 antibody was raised against the middle region of FASTKD2
- Purification
- Affinity purified
- Immunogen
- FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
- Top Product
- Discover our top product FASTKD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FASTKD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
- Alternative Name
- FASTKD2 (FASTKD2 Products)
- Synonyms
- si:ch211-103i6.5 antibody, KIAA0971 antibody, 2810421I24Rik antibody, RGD1307883 antibody, FAST kinase domains 2 antibody, FASTKD2 antibody, fastkd2 antibody, Fastkd2 antibody
- Background
- This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
- Molecular Weight
- 81 kDa (MW of target protein)
-