TSPY-Like 4 antibody (Middle Region)
-
- Target See all TSPY-Like 4 (TSPYL4) products
- TSPY-Like 4 (TSPYL4)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSPY-Like 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TSPYL4 antibody was raised against the middle region of TSPYL4
- Purification
- Affinity purified
- Immunogen
- TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPY-Like 4 (TSPYL4)
- Alternative Name
- TSPYL4 (TSPYL4 Products)
- Synonyms
- dJ486I3.2 antibody, 2610102M01Rik antibody, B230210I21Rik antibody, D10Bwg0791e antibody, TSPY like 4 antibody, TSPY-like 4 antibody, TSPYL4 antibody, Tspyl4 antibody
- Background
- TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.
- Molecular Weight
- 45 kDa (MW of target protein)
-