TSPY-Like 4 antibody (Middle Region)

Catalog No. ABIN631764

Product Details anti-TSPY-Like 4 Antibody

Target: TSPY-Like 4 (TSPYL4)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPY-Like 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TSPYL4 antibody was raised against the middle region of TSPYL4

Purification: Affinity purified

Immunogen: TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPY-Like 4

Target: TSPY-Like 4 (TSPYL4)

Alternative Name: TSPYL4 (TSPYL4 Products)

Synonyms: dJ486I3.2 antibody, 2610102M01Rik antibody, B230210I21Rik antibody, D10Bwg0791e antibody, TSPY like 4 antibody, TSPY-like 4 antibody, TSPYL4 antibody, Tspyl4 antibody

Background: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Molecular Weight: 45 kDa (MW of target protein)