KHDRBS2 antibody (Middle Region)
-
- Target See all KHDRBS2 Antibodies
- KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KHDRBS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KHDRBS2 antibody was raised against the middle region of KHDRBS2
- Purification
- Affinity purified
- Immunogen
- KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG
- Top Product
- Discover our top product KHDRBS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KHDRBS2 Blocking Peptide, catalog no. 33R-2292, is also available for use as a blocking control in assays to test for specificity of this KHDRBS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))
- Alternative Name
- KHDRBS2 (KHDRBS2 Products)
- Synonyms
- slm1 antibody, slm-1 antibody, MGC145973 antibody, ba535f17.1 antibody, zgc:153588 antibody, SLM-1 antibody, SLM1 antibody, bA535F17.1 antibody, 6330586C16Rik antibody, Slim1 antibody, Slm1 antibody, KH RNA binding domain containing, signal transduction associated 2 antibody, KH domain containing, RNA binding, signal transduction associated 2 antibody, KHDRBS2 antibody, khdrbs2 antibody, Khdrbs2 antibody
- Background
- KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.
- Molecular Weight
- 39 kDa (MW of target protein)
-