ENKD1 antibody (C-Term)

Catalog No. ABIN631839

Product Details anti-ENKD1 Antibody

Target: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENKD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 ORF48 antibody was raised against the C terminal Of C16 rf48

Purification: Affinity purified

Immunogen: C16 ORF48 antibody was raised using the C terminal Of C16 rf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16ORF48 Blocking Peptide, catalog no. 33R-2073, is also available for use as a blocking control in assays to test for specificity of this C16ORF48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENKD1

Target: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Alternative Name: C16ORF48 (ENKD1 Products)

Synonyms: C16orf48 antibody, DAKV6410 antibody, C18H16orf48 antibody, AI606951 antibody, E130303B06Rik antibody, enkurin domain containing 1 antibody, ENKD1 antibody, Enkd1 antibody

Background: The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 39 kDa (MW of target protein)