ROPN1B antibody (N-Term)

Catalog No. ABIN631847

Product Details anti-ROPN1B Antibody

Target: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ROPN1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ROPN1 B antibody was raised against the N terminal of ROPN1

Purification: Affinity purified

Immunogen: ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROPN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ROPN1B

Target: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Alternative Name: ROPN1B (ROPN1B Products)

Synonyms: rhophilin associated tail protein 1B antibody, ROPN1B antibody

Background: ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.

Molecular Weight: 24 kDa (MW of target protein)