FAM83B antibody (C-Term)

Catalog No. ABIN631856

Product Details anti-FAM83B Antibody

Target: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM83B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM83 B antibody was raised against the C terminal of FAM83

Purification: Affinity purified

Immunogen: FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM83B Blocking Peptide, catalog no. 33R-7342, is also available for use as a blocking control in assays to test for specificity of this FAM83B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM83B

Target: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Alternative Name: FAM83B (FAM83B Products)

Synonyms: fam83b antibody, C6orf143 antibody, C530008M07Rik antibody, Gm516 antibody, family with sequence similarity 83, member B antibody, family with sequence similarity 83 member B antibody, fam83b antibody, FAM83B antibody, Fam83b antibody

Background: The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 115 kDa (MW of target protein)