NUDCD3 antibody (Middle Region)
-
- Target See all NUDCD3 Antibodies
- NUDCD3 (NudC Domain Containing 3 (NUDCD3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDCD3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NUDCD3 antibody was raised against the middle region of NUDCD3
- Purification
- Affinity purified
- Immunogen
- NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD
- Top Product
- Discover our top product NUDCD3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDCD3 Blocking Peptide, catalog no. 33R-4441, is also available for use as a blocking control in assays to test for specificity of this NUDCD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDCD3 (NudC Domain Containing 3 (NUDCD3))
- Alternative Name
- NUDCD3 (NUDCD3 Products)
- Synonyms
- NudCL antibody, AI427847 antibody, BC024322 antibody, RP23-28G13.2 antibody, mKIAA1068 antibody, NudC domain containing 3 antibody, Nudcd3 antibody, NUDCD3 antibody
- Background
- The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain and mislocalization of the dynein complex from kinetochores.
- Molecular Weight
- 41 kDa (MW of target protein)
-