C1orf55 antibody (C-Term)

Catalog No. ABIN631867

Product Details anti-C1orf55 Antibody

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf55 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF55 antibody was raised against the C terminal Of C1 rf55

Purification: Affinity purified

Immunogen: C1 ORF55 antibody was raised using the C terminal Of C1 rf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF55 Blocking Peptide, catalog no. 33R-1180, is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf55

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Alternative Name: C1ORF55 (C1orf55 Products)

Synonyms: C1orf55 antibody, RP4-671D7.1 antibody, dJ671D7.1 antibody, SDE2 antibody, c1orf55 antibody, DKFZp469F1217 antibody, RGD1305572 antibody, wu:fb55e02 antibody, wu:fi34c02 antibody, zgc:112095 antibody, SDE2 telomere maintenance homolog antibody, SDE2 telomere maintenance homolog (S. pombe) S homeolog antibody, SDE2 telomere maintenance homolog (S. pombe) antibody, SDE2 antibody, sde2.S antibody, sde2 antibody, Sde2 antibody

Background: C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.

Molecular Weight: 50 kDa (MW of target protein)