TOM1L2 antibody

Catalog No. ABIN631872

Product Details anti-TOM1L2 Antibody

Target: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOM1L2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOM1L2

Target: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Alternative Name: TOM1L2 (TOM1L2 Products)

Synonyms: 2900016I08Rik antibody, A730055F12Rik antibody, AU042072 antibody, Srebf1 antibody, target of myb1 like 2 membrane trafficking protein antibody, target of myb1 like 2 membrane trafficking protein L homeolog antibody, target of myb1-like 2 (chicken) antibody, TOM1L2 antibody, tom1l2.L antibody, Tom1l2 antibody

Background: TOM1L2 may regulate growth factor-induced mitogenic signaling.

Molecular Weight: 55 kDa (MW of target protein)