TOM1L2 antibody
-
- Target See all TOM1L2 Antibodies
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOM1L2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
- Top Product
- Discover our top product TOM1L2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
- Alternative Name
- TOM1L2 (TOM1L2 Products)
- Synonyms
- 2900016I08Rik antibody, A730055F12Rik antibody, AU042072 antibody, Srebf1 antibody, target of myb1 like 2 membrane trafficking protein antibody, target of myb1 like 2 membrane trafficking protein L homeolog antibody, target of myb1-like 2 (chicken) antibody, TOM1L2 antibody, tom1l2.L antibody, Tom1l2 antibody
- Background
- TOM1L2 may regulate growth factor-induced mitogenic signaling.
- Molecular Weight
- 55 kDa (MW of target protein)
-