DPH2 antibody
-
- Target See all DPH2 Antibodies
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA
- Top Product
- Discover our top product DPH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPH2 Blocking Peptide, catalog no. 33R-9317, is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
- Alternative Name
- DPH2 (DPH2 Products)
- Synonyms
- DPH2L2 antibody, 9130020C19Rik antibody, AI467389 antibody, Dph2l2 antibody, id:ibd5058 antibody, zgc:162269 antibody, DPH2 homolog antibody, DPH2 homolog (S. cerevisiae) antibody, hypothetical protein antibody, DPH2 antibody, Dph2 antibody, dph2 antibody, CAALFM_C400690CA antibody
- Background
- DPH2 gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 52 kDa (MW of target protein)
-