YTHDF3 antibody (N-Term)
-
- Target See all YTHDF3 Antibodies
- YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This YTHDF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- YTHDF3 antibody was raised against the N terminal of YTHDF3
- Purification
- Affinity purified
- Immunogen
- YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ
- Top Product
- Discover our top product YTHDF3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
YTHDF3 Blocking Peptide, catalog no. 33R-3217, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))
- Alternative Name
- YTHDF3 (YTHDF3 Products)
- Synonyms
- wu:fi35c09 antibody, zgc:55441 antibody, 9130022A11Rik antibody, YTH N6-methyladenosine RNA binding protein 3 antibody, YTH N(6)-methyladenosine RNA binding protein 3 antibody, YTH domain family 3 antibody, YTH N6-methyladenosine RNA binding protein 3 S homeolog antibody, ythdf3 antibody, YTHDF3 antibody, Ythdf3 antibody, ythdf3.S antibody
- Background
- YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.
- Molecular Weight
- 64 kDa (MW of target protein)
-