C10ORF96 antibody (Middle Region)
-
- Target See all C10ORF96 (C10orf96) Antibodies
- C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C10ORF96 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C10 ORF96 antibody was raised against the middle region of C10 rf96
- Purification
- Affinity purified
- Immunogen
- C10 ORF96 antibody was raised using the middle region of C10 rf96 corresponding to a region with amino acids QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE
- Top Product
- Discover our top product C10orf96 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C10ORF96 Blocking Peptide, catalog no. 33R-7713, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF96 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))
- Alternative Name
- C10ORF96 (C10orf96 Products)
- Synonyms
- C9H10orf96 antibody, C10orf96 antibody, C26H10orf96 antibody, 1700011F14Rik antibody, coiled-coil domain containing 172 antibody, coiled-coil domain containing 172 L homeolog antibody, CCDC172 antibody, Ccdc172 antibody, ccdc172.L antibody
- Background
- The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 31 kDa (MW of target protein)
-