FAM92B antibody (N-Term)
-
- Target See all FAM92B products
- FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM92B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM92 B antibody was raised against the N terminal of FAM92
- Purification
- Affinity purified
- Immunogen
- FAM92 B antibody was raised using the N terminal of FAM92 corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM92B Blocking Peptide, catalog no. 33R-2839, is also available for use as a blocking control in assays to test for specificity of this FAM92B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))
- Alternative Name
- FAM92B (FAM92B Products)
- Synonyms
- 1700120B06Rik antibody, RGD1560673 antibody, family with sequence similarity 92 member B antibody, family with sequence similarity 92, member B antibody, FAM92B antibody, Fam92b antibody
- Background
- The function of FAM92 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 35 kDa (MW of target protein)
-