ZCCHC24 antibody (Middle Region)

Catalog No. ABIN631945

Product Details anti-ZCCHC24 Antibody

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCCHC24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF56 antibody was raised against the middle region of C10 rf56

Purification: Affinity purified

Immunogen: C10 ORF56 antibody was raised using the middle region of C10 rf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF56 Blocking Peptide, catalog no. 33R-5470, is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCCHC24

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Alternative Name: C10ORF56 (ZCCHC24 Products)

Synonyms: RGD1306164 antibody, fc45d05 antibody, wu:fc45d05 antibody, zgc:158323 antibody, C10orf56 antibody, 2310047A01Rik antibody, zinc finger CCHC-type containing 24 antibody, zinc finger, CCHC domain containing 24 antibody, Zcchc24 antibody, ZCCHC24 antibody, zcchc24 antibody

Background: C10orf56 is probably involved in oxidoreductase activity.

Molecular Weight: 27 kDa (MW of target protein)