ANKRD5 antibody (N-Term)

Catalog No. ABIN631952

Product Details anti-ANKRD5 Antibody

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANKRD5 antibody was raised against the N terminal of ANKRD5

Purification: Affinity purified

Immunogen: ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD5 Blocking Peptide, catalog no. 33R-6546, is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD5

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Alternative Name: ANKRD5 (ANKRD5 Products)

Synonyms: anr5 antibody, MGC146428 antibody, DKFZp469P046 antibody, ANKRD5 antibody, dJ839B4.6 antibody, AV276460 antibody, Ankrd5 antibody, ankyrin repeat and EF-hand domain containing 1 L homeolog antibody, ankyrin repeat and EF-hand domain containing 1 antibody, ankef1.L antibody, ankef1 antibody, ANKEF1 antibody, Ankef1 antibody

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 87 kDa (MW of target protein)