RSPH10B antibody

Catalog No. ABIN631980

Product Details anti-RSPH10B Antibody

Target: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSPH10B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSPH10B

Target: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Alternative Name: RSPH10B (RSPH10B Products)

Synonyms: RSPH10B2 antibody, RGD1311893 antibody, radial spoke head 10 homolog B antibody, radial spoke head 10 homolog B (Chlamydomonas) antibody, RSPH10B antibody, Rsph10b antibody

Background: The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 96 kDa (MW of target protein)