MRGBP antibody (Middle Region)
-
- Target See all MRGBP Antibodies
- MRGBP (MRG-Binding Protein (MRGBP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRGBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C20 ORF20 antibody was raised against the middle region of C20 rf20
- Purification
- Affinity purified
- Immunogen
- C20 ORF20 antibody was raised using the middle region of C20 rf20 corresponding to a region with amino acids LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM
- Top Product
- Discover our top product MRGBP Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C20ORF20 Blocking Peptide, catalog no. 33R-5460, is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRGBP (MRG-Binding Protein (MRGBP))
- Alternative Name
- C20ORF20 (MRGBP Products)
- Synonyms
- C20orf20 antibody, Eaf7 antibody, MRG15BP antibody, URCC4 antibody, c20orf20 antibody, zgc:73167 antibody, 1600027N09Rik antibody, AW060503 antibody, C80444 antibody, MRG domain binding protein antibody, MRG/MORF4L-binding protein antibody, MRG-binding protein antibody, putative mrg-binding protein antibody, MRG/MORF4L binding protein antibody, MRGBP antibody, LOC5577096 antibody, CpipJ_CPIJ006487 antibody, CpipJ_CPIJ017611 antibody, Smp_130630 antibody, mrgbp antibody, Mrgbp antibody
- Background
- C20orf20 belongs to the EAF7 family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
- Molecular Weight
- 22 kDa (MW of target protein)
-