PSG6 antibody (N-Term)

Catalog No. ABIN631999

Product Details anti-PSG6 Antibody

Target: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSG6 antibody was raised against the N terminal of PSG6

Purification: Affinity purified

Immunogen: PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG6

Target: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Alternative Name: PSG6 (PSG6 Products)

Synonyms: PSBG-10 antibody, PSBG-12 antibody, PSBG-6 antibody, PSG10 antibody, PSGGB antibody, PSG6 antibody, PSG3 antibody, pregnancy specific beta-1-glycoprotein 6 antibody, pregnancy-specific beta-1-glycoprotein 4 antibody, PSG6 antibody, LOC456082 antibody

Background: PSG6 may have a role in modulation of the innate immune system.

Molecular Weight: 47 kDa (MW of target protein)