N6AMT1 antibody
-
- Target See all N6AMT1 Antibodies
- N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This N6AMT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- N6 AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
- Top Product
- Discover our top product N6AMT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
N6AMT1 Blocking Peptide, catalog no. 33R-5659, is also available for use as a blocking control in assays to test for specificity of this N6AMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of N0 MT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))
- Alternative Name
- N6AMT1 (N6AMT1 Products)
- Synonyms
- HEMK2 antibody, C21orf127 antibody, N6AMT1 antibody, MTQ2 antibody, N6AMT antibody, 5830445C04Rik antibody, Hemk2 antibody, Pred28 antibody, RGD1311843 antibody, N-6 adenine-specific DNA methyltransferase 1 (putative) antibody, N-6 adenine-specific DNA methyltransferase 1 antibody, HemK methyltransferase family member 2 antibody, uncharacterized LOC100283871 antibody, N6AMT1 antibody, CpipJ_CPIJ001152 antibody, LOC100283871 antibody, N6amt1 antibody
- Background
- The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
- Molecular Weight
- 20 kDa (MW of target protein)
-