NOC3L antibody
-
- Target See all NOC3L Antibodies
- NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOC3L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NOC3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL
- Top Product
- Discover our top product NOC3L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOC3L Blocking Peptide, catalog no. 33R-9174, is also available for use as a blocking control in assays to test for specificity of this NOC3L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))
- Alternative Name
- NOC3L (NOC3L Products)
- Synonyms
- AD24 antibody, C10orf117 antibody, FAD24 antibody, AF233884 antibody, Fad24 antibody, RGD1560656 antibody, NOC3 protein homolog antibody, c10orf117 antibody, cb522 antibody, sb:cb522 antibody, NOC3 like DNA replication regulator antibody, NOC3-like DNA replication regulator S homeolog antibody, NOC3-like DNA replication regulator antibody, nucleolar complex associated 3 homolog (S. cerevisiae) antibody, NOC3L antibody, Noc3l antibody, noc3l.S antibody, noc3l antibody
- Background
- NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.
- Molecular Weight
- 92 kDa (MW of target protein)
-