NOXRED1 antibody (Middle Region)

Catalog No. ABIN632026

Product Details anti-NOXRED1 Antibody

Target: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOXRED1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF148 antibody was raised against the middle region of C14 rf148

Purification: Affinity purified

Immunogen: C14 ORF148 antibody was raised using the middle region of C14 rf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF148 Blocking Peptide, catalog no. 33R-4517, is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF148 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOXRED1

Target: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Alternative Name: C14ORF148 (C14orf148 Products)

Synonyms: C14orf148 antibody, 4933437F05Rik antibody, NADP dependent oxidoreductase domain containing 1 antibody, NADP+ dependent oxidoreductase domain containing 1 antibody, NOXRED1 antibody, Noxred1 antibody

Background: C14Orf148 probably functions an an oxidoreductase.

Molecular Weight: 39 kDa (MW of target protein)