TCP11 antibody
-
- Target See all TCP11 Antibodies
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TCP11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD
- Top Product
- Discover our top product TCP11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TCP11 Blocking Peptide, catalog no. 33R-2078, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
- Alternative Name
- TCP11 (TCP11 Products)
- Synonyms
- D6S230E antibody, FPPR antibody, D17Ken1 antibody, Tcp-11 antibody, t-complex 11 antibody, t-complex protein 11 antibody, Tcp11 antibody, TCP11 antibody
- Background
- TCP11 may play an important role in sperm function and fertility.
- Molecular Weight
- 49 kDa (MW of target protein)
-