ALDH1L1 antibody (Middle Region)

Catalog No. ABIN632033

Product Details anti-ALDH1L1 Antibody

Target: ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDH1 L1 antibody was raised against the middle region of ALDH1 1

Purification: Affinity purified

Immunogen: ALDH1 L1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH1L1

Target: ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))

Alternative Name: ALDH1L1 (ALDH1L1 Products)

Synonyms: 10-FTHFDH antibody, 10-fTHF antibody, FDH antibody, FTHFD antibody, Fthfd antibody, 1810048F20Rik antibody, Neut2 antibody, fthfd antibody, ALDH1L1 antibody, DKFZp469C068 antibody, aldehyde dehydrogenase 1 family member L1 antibody, aldehyde dehydrogenase 1 family, member L1 antibody, cytosolic 10-formyltetrahydrofolate dehydrogenase antibody, aldehyde dehydrogenase 1 family member L1 L homeolog antibody, ALDH1L1 antibody, Aldh1l1 antibody, aldh1l1 antibody, LOC476506 antibody, LOC100465263 antibody, aldh1l1.L antibody

Background: ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.

Molecular Weight: 99 kDa (MW of target protein)