PI4K2B antibody (Middle Region)
-
- Target See all PI4K2B Antibodies
- PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PI4K2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PI4 K4 antibody was raised against the middle region of PI4 4
- Purification
- Affinity purified
- Immunogen
- PI4 K4 antibody was raised using the middle region of PI4 4 corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA
- Top Product
- Discover our top product PI4K2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PI4K2B Blocking Peptide, catalog no. 33R-3999, is also available for use as a blocking control in assays to test for specificity of this PI4K2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))
- Alternative Name
- PI4K2B (PI4K2B Products)
- Synonyms
- GB16449 antibody, pi4kiib antibody, pik42b antibody, PI4KIIB antibody, PIK42B antibody, 2610042N09Rik antibody, 4933409G22Rik antibody, zgc:158305 antibody, uncharacterized LOC725812 antibody, phosphatidylinositol 4-kinase type 2 beta L homeolog antibody, phosphatidylinositol 4-kinase type 2 beta antibody, LOC725812 antibody, pi4k2b.L antibody, PI4K2B antibody, pi4k2b antibody, Pi4k2b antibody
- Background
- Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-