ASPA antibody
-
- Target See all ASPA Antibodies
- ASPA (Aspartoacylase (ASPA))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASPA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL
- Top Product
- Discover our top product ASPA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASPA Blocking Peptide, catalog no. 33R-4033, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASPA (Aspartoacylase (ASPA))
- Alternative Name
- ASPA (ASPA Products)
- Synonyms
- asp antibody, acy2 antibody, ACY-2 antibody, ASP antibody, ACY2 antibody, Acy-2 antibody, Acy2 antibody, nur7 antibody, zgc:171507 antibody, aspartoacylase antibody, Aspartoacylase antibody, ASPA antibody, aspa antibody, Fbal_2465 antibody, Aspa antibody
- Background
- ASPA catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids.
- Molecular Weight
- 36 kDa (MW of target protein)
-