ASPA antibody

Catalog No. ABIN632065

This Rabbit Polyclonal antibody specifically detects ASPA in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ASPA antibody (ABIN632065)

Target: ASPA (Aspartoacylase (ASPA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASPA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASPA Antibody

Purification: Affinity purified

Immunogen: ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASPA Blocking Peptide, (ABIN939419), is also available for use as a blocking control in assays to test for specificity of this ASPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASPA

Target: ASPA (Aspartoacylase (ASPA))

Alternative Name: ASPA

Background: ASPA catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids.

Molecular Weight: 36 kDa (MW of target protein)