PLEKHH2 antibody
-
- Target See all PLEKHH2 products
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLEKHH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PLEKHH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLEKHH2 Blocking Peptide, catalog no. 33R-9995, is also available for use as a blocking control in assays to test for specificity of this PLEKHH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
- Alternative Name
- PLEKHH2 (PLEKHH2 Products)
- Synonyms
- RGD1304935 antibody, si:ch73-105b23.3 antibody, PLEKHH1L antibody, AI256725 antibody, E030001K05 antibody, mKIAA2028 antibody, pleckstrin homology, MyTH4 and FERM domain containing H2 antibody, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 antibody, Plekhh2 antibody, plekhh2 antibody, PLEKHH2 antibody
- Background
- PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
- Molecular Weight
- 168 kDa (MW of target protein)
-