C16orf61 antibody (Middle Region)
-
- Target See all C16orf61 Antibodies
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C16orf61 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C16 ORF61 antibody was raised against the middle region of C16 rf61
- Purification
- Affinity purified
- Immunogen
- C16 ORF61 antibody was raised using the middle region of C16 rf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
- Top Product
- Discover our top product C16orf61 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF61 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
- Alternative Name
- C16ORF61 (C16orf61 Products)
- Synonyms
- 1110046L09Rik antibody, 2310061C15Rik antibody, DC13 antibody, C16orf61 antibody, C18H16orf61 antibody, si:busm1-241h12.4 antibody, si:dz241h12.4 antibody, zgc:92271 antibody, C-x(9)-C motif containing 2 antibody, C-x(9)-C motif containing 2 S homeolog antibody, COX assembly mitochondrial protein 2 antibody, C-X9-C motif containing 2 antibody, cmc2 antibody, cmc2.S antibody, CMC2 antibody, Cmc2 antibody
- Background
- The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 9 kDa (MW of target protein)
-