ASXL2 antibody
-
- Target See all ASXL2 Antibodies
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASXL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
- Top Product
- Discover our top product ASXL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASXL2 Blocking Peptide, catalog no. 33R-2337, is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
- Alternative Name
- ASXL2 (ASXL2 Products)
- Synonyms
- asxh2 antibody, ASXH2 antibody, 4930556B16Rik antibody, mKIAA1685 antibody, additional sex combs like 2, transcriptional regulator antibody, additional sex combs like 2 (Drosophila) antibody, Asxl2 antibody, ASXL2 antibody, asxl2 antibody
- Background
- ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.
- Molecular Weight
- 154 kDa (MW of target protein)
- Pathways
- Positive Regulation of fat Cell Differentiation
-