THG1L antibody
-
- Target See all THG1L Antibodies
- THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This THG1L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- THG1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY
- Top Product
- Discover our top product THG1L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
THG1L Blocking Peptide, catalog no. 33R-1871, is also available for use as a blocking control in assays to test for specificity of this THG1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THG0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))
- Alternative Name
- THG1L (THG1L Products)
- Synonyms
- ICF45 antibody, IHG-1 antibody, 1700121M19Rik antibody, 5730409G07Rik antibody, AA387658 antibody, tRNA-histidine guanylyltransferase 1 like antibody, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) antibody, tRNA-histidine guanylyltransferase 1-like antibody, THG1L antibody, Thg1l antibody
- Background
- THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.
- Molecular Weight
- 35 kDa (MW of target protein)
-