RAI14 antibody (Middle Region)

Catalog No. ABIN632115

Product Details anti-RAI14 Antibody

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAI14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAI14 antibody was raised against the middle region of RAI14

Purification: Affinity purified

Immunogen: RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAI14 Blocking Peptide, catalog no. 33R-5446, is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAI14

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Alternative Name: RAI14 (RAI14 Products)

Synonyms: RAI14 antibody, NORPEG antibody, RAI13 antibody, 1700008J19Rik antibody, 1700020L11Rik antibody, Ankycorbin antibody, Norpeg antibody, mKIAA1334 antibody, retinoic acid induced 14 antibody, ankycorbin antibody, RAI14 antibody, rai14 antibody, LOC100541535 antibody, Rai14 antibody

Background: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Molecular Weight: 110 kDa (MW of target protein)