CCDC69 antibody (Middle Region)

Catalog No. ABIN632117

Product Details anti-CCDC69 Antibody

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC69 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC69 antibody was raised against the middle region of CCDC69

Purification: Affinity purified

Immunogen: CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC69 Blocking Peptide, catalog no. 33R-9255, is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC69 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC69

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Alternative Name: CCDC69 (CCDC69 Products)

Synonyms: ccdc69 antibody, MGC83627 antibody, MGC147153 antibody, 2210021E03Rik antibody, D11Ertd461e antibody, RGD1562251 antibody, coiled-coil domain containing 69 antibody, coiled-coil domain containing 69 S homeolog antibody, coiled-coil domain containing 69 L homeolog antibody, CCDC69 antibody, ccdc69.S antibody, ccdc69 antibody, ccdc69.L antibody, Ccdc69 antibody

Background: The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)