QRSL1 antibody
-
- Target See all QRSL1 Antibodies
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This QRSL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT
- Top Product
- Discover our top product QRSL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
QRSL1 Blocking Peptide, catalog no. 33R-8956, is also available for use as a blocking control in assays to test for specificity of this QRSL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QRSL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
- Alternative Name
- QRSL1 (QRSL1 Products)
- Synonyms
- 0929/02 antibody, CG6007 antibody, Dmel\\CG6007 antibody, bene antibody, benedict antibody, l(3)S092902 antibody, wu:fi03b10 antibody, GatA antibody, 2700038P16Rik antibody, C80053 antibody, Glutamyl-tRNA amidotransferase, subunit A antibody, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 antibody, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 L homeolog antibody, GatA antibody, qrsl1 antibody, qrsl1.L antibody, QRSL1 antibody, Qrsl1 antibody
- Background
- The function of the QRSL1 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 57 kDa (MW of target protein)
-