EIF3E antibody (Middle Region)
-
- Target See all EIF3E Antibodies
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF3E antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF3 E antibody was raised against the middle region of EIF3
- Purification
- Affinity purified
- Immunogen
- EIF3 E antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK
- Top Product
- Discover our top product EIF3E Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF3E Blocking Peptide, catalog no. 33R-5232, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
- Alternative Name
- EIF3E (EIF3E Products)
- Synonyms
- EIF3-P48 antibody, EIF3S6 antibody, INT6 antibody, eIF3-p46 antibody, 48kDa antibody, Eif3s6 antibody, Int6 antibody, eIF3-p48 antibody, eif3-p48 antibody, eif3s6 antibody, eif3s6-A antibody, eIF3e antibody, eIF3-S6 antibody, eif3s6-B antibody, EIF3SE antibody, eif3s6b antibody, im:7147439 antibody, QtsA-18056 antibody, eukaryotic translation initiation factor 3 subunit E antibody, eukaryotic translation initiation factor 3, subunit E antibody, eukaryotic translation initiation factor 3 subunit E L homeolog antibody, eukaryotic translation initiation factor 3 subunit 6 antibody, eukaryotic translation initiation factor 3 subunit E S homeolog antibody, eukaryotic translation initiation factor 3, subunit E, a antibody, Eukaryotic translation initiation factor 3 subunit E antibody, eukaryotic translation initiation factor 3, subunit E, b antibody, EIF3E antibody, Eif3e antibody, eif3e antibody, eif3e.L antibody, LOC692936 antibody, eif3e.S antibody, eif3ea antibody, eif-3.E antibody, eif3eb antibody, LOC108348260 antibody, int6 antibody
- Background
- EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Hepatitis C
-