ST14 antibody
-
- Target See all ST14 Antibodies
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV
- Top Product
- Discover our top product ST14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST14 Blocking Peptide, catalog no. 33R-7953, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
- Alternative Name
- ST14 (ST14 Products)
- Synonyms
- HAI antibody, MT-SP1 antibody, MTSP1 antibody, PRSS14 antibody, SNC19 antibody, TADG15 antibody, TMPRSS14 antibody, XMT-SP1 antibody, hai antibody, mt-sp1 antibody, mtsp1 antibody, prss14 antibody, snc19 antibody, st14 antibody, st14a antibody, tadg15 antibody, tmprss1 antibody, Epithin antibody, Prss14 antibody, Tmprss14 antibody, mCAP3 antibody, matriptase antibody, suppression of tumorigenicity 14 antibody, suppression of tumorigenicity 14 L homeolog antibody, suppression of tumorigenicity 14 (colon carcinoma) antibody, ST14 antibody, st14.L antibody, St14 antibody
- Background
- ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
- Molecular Weight
- 95 kDa (MW of target protein)
-