TMOD3 antibody
-
- Target See all TMOD3 Antibodies
- TMOD3 (Tropomodulin 3 (TMOD3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMOD3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT
- Top Product
- Discover our top product TMOD3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tropomodulin 3 Blocking Peptide, catalog no. 33R-4183, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMOD3 (Tropomodulin 3 (TMOD3))
- Alternative Name
- Tropomodulin 3 (TMOD3 Products)
- Synonyms
- TMOD3 antibody, tropomodulin-3 antibody, UTMOD antibody, MGC53545 antibody, U-Tmod antibody, tropomodulin 3 antibody, tropomodulin 3 S homeolog antibody, TMOD3 antibody, Tmod3 antibody, tmod3.S antibody, tmod3 antibody
- Background
- TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-