WBP2 antibody (N-Term)

Catalog No. ABIN632196

Product Details anti-WBP2 Antibody

Target: WBP2 (WW Domain Binding Protein 2 (WBP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WBP2 antibody was raised against the N terminal of WBP2

Purification: Affinity purified

Immunogen: WBP2 antibody was raised using the N terminal of WBP2 corresponding to a region with amino acids MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WBP2 Blocking Peptide, catalog no. 33R-6156, is also available for use as a blocking control in assays to test for specificity of this WBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WBP2

Target: WBP2 (WW Domain Binding Protein 2 (WBP2))

Alternative Name: WBP2 (WBP2 Products)

Synonyms: WBP-2 antibody, MGC68743 antibody, wbp-2 antibody, zgc:109985 antibody, WW domain binding protein 2 antibody, WW domain binding protein 2 L homeolog antibody, WBP2 antibody, Wbp2 antibody, wbp2.L antibody, wbp2 antibody

Background: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Molecular Weight: 28 kDa (MW of target protein)