C11orf65 antibody (N-Term)
-
- Target See all C11orf65 products
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C11orf65 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C11 ORF65 antibody was raised against the N terminal Of C11 rf65
- Purification
- Affinity purified
- Immunogen
- C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C11ORF65 Blocking Peptide, catalog no. 33R-6312, is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
- Alternative Name
- C11ORF65 (C11orf65 Products)
- Synonyms
- AU017961 antibody, chromosome 11 open reading frame 65 antibody, chromosome 11 open reading frame 65 L homeolog antibody, chromosome 14 open reading frame, human C11orf65 antibody, RIKEN cDNA 4930550C14 gene antibody, similar to RIKEN cDNA 4930550C14 antibody, C11orf65 antibody, c11orf65.L antibody, C14H11orf65 antibody, 4930550C14Rik antibody, RGD1311251 antibody
- Background
- The specific function of C11orf65 is not yet known.
- Molecular Weight
- 37 kDa (MW of target protein)
-