C17orf57 antibody (N-Term)

Catalog No. ABIN632216

Product Details anti-C17orf57 Antibody

Target: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C17orf57 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C17 ORF57 antibody was raised against the N terminal Of C17 rf57

Purification: Affinity purified

Immunogen: C17 ORF57 antibody was raised using the N terminal Of C17 rf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF57 Blocking Peptide, catalog no. 33R-1694, is also available for use as a blocking control in assays to test for specificity of this C17ORF57 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C17orf57

Target: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Alternative Name: C17ORF57 (C17orf57 Products)

Synonyms: C17orf57 antibody, EF-hand calcium binding domain 13 antibody, EFCAB13 antibody

Background: The function of C17orf57 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 110 kDa (MW of target protein)