ZSWIM3 antibody (N-Term)
-
- Target See all ZSWIM3 products
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZSWIM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZSWIM3 antibody was raised against the N terminal of ZSWIM3
- Purification
- Affinity purified
- Immunogen
- ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZSWIM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
- Alternative Name
- ZSWIM3 (ZSWIM3 Products)
- Synonyms
- 4921517A06Rik antibody, C86566 antibody, C20orf164 antibody, zinc finger SWIM-type containing 3 antibody, zinc finger, SWIM-type containing 3 antibody, ZSWIM3 antibody, Zswim3 antibody
- Background
- The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 77 kDa (MW of target protein)
-