ZSWIM3 antibody (N-Term)

Catalog No. ABIN632219

Product Details anti-ZSWIM3 Antibody

Target: ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZSWIM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZSWIM3 antibody was raised against the N terminal of ZSWIM3

Purification: Affinity purified

Immunogen: ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZSWIM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZSWIM3

Target: ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))

Alternative Name: ZSWIM3 (ZSWIM3 Products)

Synonyms: 4921517A06Rik antibody, C86566 antibody, C20orf164 antibody, zinc finger SWIM-type containing 3 antibody, zinc finger, SWIM-type containing 3 antibody, ZSWIM3 antibody, Zswim3 antibody

Background: The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 77 kDa (MW of target protein)