EBI3 antibody (Middle Region)
-
- Target See all EBI3 (IL-27b) Antibodies
- EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EBI3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EBI3 antibody was raised against the middle region of EBI3
- Purification
- Affinity purified
- Immunogen
- EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP
- Top Product
- Discover our top product IL-27b Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EBI3 Blocking Peptide, catalog no. 33R-8990, is also available for use as a blocking control in assays to test for specificity of this EBI3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBI3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))
- Alternative Name
- EBI3 (IL-27b Products)
- Synonyms
- IL-27B antibody, IL27B antibody, EBI3 antibody, il-27rb antibody, si:dkey-97a13.4 antibody, EBI-3 antibody, IL-27 antibody, Epstein-Barr virus induced 3 antibody, Epstein-Barr virus induced gene 3 antibody, EBI3 antibody, ebi3 antibody, Ebi3 antibody
- Target Type
- Viral Protein
- Background
- This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
- Molecular Weight
- 23 kDa (MW of target protein)
-